Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

856 – 870 of 1,807,439 results

856

Invitrogen™ PAX4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	O43316, P32115
Isotype	IgG
Concentration	1 mg/mL
Antigen	PAX4
Gene Symbols	PAX4
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	KPD; MGC129960; MODY9; paired box 4; paired box gene 4; paired box protein Pax-4; paired domain gene 4; Pax4; Pax-4
Gene	PAX4
Product Type	Antibody
Gene ID (Entrez)	18506, 5078
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Amino acids 128-350 of human PAX4.
Classification	Polyclonal
Primary or Secondary	Primary

857

Invitrogen™ PPAR gamma-2 Polyclonal Antibody, Alexa Fluor™ 647

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P37231, P37238
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	PPAR gamma-2
Gene Symbols	PPARG
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CIMT1; GLM1; Nr1c3; nuclear receptor subfamily 1 group C member 3; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor gamma; peroxisome proliferator activated receptor gamma 2; peroxisome proliferator activated receptor gamma 4; peroxisome proliferator-activated nuclear receptor gamma variant 1; peroxisome proliferator-activated receptor gamma; PPARG; PPARG1; PPARG2; PPARgamma; PPAR-gamma; PPARgamma2; PPAR-gamma2
Gene	PPARG
Product Type	Antibody
Gene ID (Entrez)	19016, 5468
Formulation	PBS with 1.0mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues M(1) G E T L G D S P I D P E S D S(16) C of human PPAR gamma-2.
Classification	Polyclonal
Primary or Secondary	Primary

858

Invitrogen™ Endothelin 2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P20800
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	Endothelin 2
Gene Symbols	EDN2
Regulatory Status	RUO
Gene Alias	EDN 2; Edn2; EDN-2; endothelin 2; Endothelin isopeptide 2; endothelin-2; ET2; ET-2; PP ET-2; PPET2; preproendothelin 2; preproendothelin-2; RNEDN2S01; vasoactive intestinal contractor; vasoactive intestinal contractor peptide; VIC
Gene	EDN2
Product Type	Antibody
Gene ID (Entrez)	1907
Formulation	Whole serum with 0.05% sodium azide
Immunogen	KLH conjugated Cys-S-Abu-SSWLDKE-Abu-VYF-Abu-HLDIIW.
Classification	Polyclonal
Primary or Secondary	Primary

859

Invitrogen™ HSF1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,C. elegans
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Gel Shift,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P38532, Q00613
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	HSF1
Gene Symbols	Hsf1
Regulatory Status	RUO
Gene Alias	AA960185; heat shock factor 1; heat shock factor 2; Heat shock factor protein 1; Heat shock transcription factor 1; heat shock transcription factor 1 alpha isoform; heat shock transcription factor 1 beta isoform; heat shock transcription factor 1 gammaalpha isoform; heat shock transcription factor 1 gammabeta isoform; HSF; HSF 1; Hsf1; Hsf1alpha; Hsf1beta; Hsf1gammaalpha; Hsf1gammabeta; HSTF 1; HSTF1
Gene	Hsf1
Product Type	Antibody
Gene ID (Entrez)	15499, 3297
Formulation	Whole serum, PBS with 0.05% sodium azide
Immunogen	Recombinant human HSF1 expressed in E. coli.
Classification	Polyclonal
Primary or Secondary	Primary

860

Invitrogen™ Endothelin A Receptor Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	P25101, P26684, Q61614
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	Endothelin A Receptor
Gene Symbols	EDNRA
Regulatory Status	RUO
Gene Alias	Ednra; Endor; Endothelin A; endothelin A receptor; endothelin receptor subtype A; endothelin receptor type A; endothelin type A receptor; endothelin-1 receptor; endothelin-1-specific receptor; ETa; ET-A; ETAR; ET-AR; ETA-R; ETRA; G protein coupled receptor; G protein-coupled receptor; Gpcr10; G-protein coupled receptor 10; hET-AR; MFDA; RGD1559432
Gene	EDNRA
Product Type	Antibody
Gene ID (Entrez)	13617, 1909, 24326
Formulation	Whole serum with 0.02% sodium azide
Immunogen	COOH-terminal amino acids of mouse ETA (408-427) KNQEQNNHNTERSSHKDSMN coupled to KLH.
Classification	Polyclonal
Primary or Secondary	Primary

861

Invitrogen™ Endothelin 1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05305, P22387, P22388
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	Endothelin 1
Gene Symbols	EDN1
Regulatory Status	RUO
Gene Alias	ARCND3; Big endothelin 1; Big endothelin-1; Big ET; Big ET 1; Big ET1; BigET; EDN1; endothelin 1; endothelin-1; Et; ET1; ET-1; HDLCQ7; PPET1; ppET-1; preproendothelin; preproendothelin-1; preproET; QME
Gene	EDN1
Product Type	Antibody
Gene ID (Entrez)	13614, 1906, 24323
Formulation	Whole serum with 0.02% sodium azide
Immunogen	Mouse Endothelin-1 CS-Abu-SSLMDKE-Abu-VYF-Abu-HLDIIW coupled to KLH.
Classification	Polyclonal
Primary or Secondary	Primary

862

Invitrogen™ GPR20 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q8BYC4
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	GPR20
Gene Symbols	GPR20
Regulatory Status	RUO
Gene Alias	A430106B11Rik; CTD-3064M3.3; G protein-coupled receptor 20; G protein-coupled receptor 5-1; G protein-coupled receptor GPR20; Gpcr5-1; GPR20; G-protein coupled receptor 20; P2Y4
Gene	GPR20
Product Type	Antibody
Gene ID (Entrez)	239530
Formulation	whole serum with 0.02% sodium azide
Immunogen	COOH-terminal amino acids of mouse GPR20 (338-358) IHILSIGSHTLTQPLTNGPEP coupled to KLH.
Classification	Polyclonal
Primary or Secondary	Primary

863

Invitrogen™ CXCR7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O89039, P25106, P56485
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	CXCR7
Gene Symbols	Ackr3
Regulatory Status	RUO
Gene Alias	ACKR3; Atypical chemokine receptor 3; AW541270; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; chemokine; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1; Cmkor1; CXC; C-X-C chemokine receptor type 7; CXC motif chemokine; CXCR7; CXC-R7; CXCR-7; G protein-coupled receptor; GPR159; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC1; RDC-1
Gene	Ackr3
Product Type	Antibody
Gene ID (Entrez)	12778, 57007, 84348
Formulation	Whole serum with 0.02% sodium azide
Immunogen	COOH-terminal amino acids of mouse CXCR7 (347-362) SRVSETEYSALEQNTK coupled to KLH.
Classification	Polyclonal
Primary or Secondary	Primary

864

Invitrogen™ PTH1R Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q03431
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	PTH1R
Gene Symbols	Pth1r
Regulatory Status	RUO
Gene Alias	MGC138426; MGC138452; Parathormone; Parathyrin; parathyroid hormone 1 receptor; parathyroid hormone receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related peptide receptor; parathyroid hormone/parathyroid hormone-related protein receptor; PFE; PPR; PTH; PTH/PTHr receptor; PTH/PTHrP receptor; PTH/PTHrP type I receptor; PTH1 receptor; PTH1R; Pthr; Pthr1; PTHrel; PTH-related peptide receptor; PTHrP-R; PTHrP-receptor; seven transmembrane helix receptor
Gene	Pth1r
Product Type	Antibody
Gene ID (Entrez)	5745
Formulation	whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to the C-terminal amino acids E(573)EASGPERPPALLQEEWETVM(593) of PTHR1.
Classification	Polyclonal
Primary or Secondary	Primary

865

Invitrogen™ SSTR5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O08858, P30938
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	SSTR5
Gene Symbols	Sstr5
Regulatory Status	RUO
Gene Alias	Smstr5; Somato; somatostatin receptor; somatostatin receptor 5; Somatostatin receptor subtype 5; somatostatin receptor type 5; SS5R; SS-5-R; SS5-R; sst5; Sstr5
Gene	Sstr5
Product Type	Antibody
Gene ID (Entrez)	20609, 25354
Formulation	whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to the C-terminal amino acids Q(344)ATLPTRSCEANGLMQTSRI(363) of SSTR5.
Classification	Polyclonal
Primary or Secondary	Primary

866

Invitrogen™ NPS Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunocytochemistry
Form	Liquid
Gene Accession No.	P0C0P6, P0C0P7, P0C0P8
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	NPS
Gene Symbols	NPS
Regulatory Status	RUO
Gene Alias	ENSMUSG00000073804; Neuropeptide S; NPS; prepro-neuropeptide S
Gene	NPS
Product Type	Antibody
Gene ID (Entrez)	100043254, 100360071, 594857
Formulation	whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to SFRNGVGTGMKKTSFQRAKS of NPS.
Classification	Polyclonal
Primary or Secondary	Primary

867

Invitrogen™ NTSR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P30989
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	NTSR1
Gene Symbols	NTSR1
Regulatory Status	RUO
Gene Alias	bK445C9.6; FLJ22086; High-affinity levocabastine-insensitive neurotensin receptor; hNtr1; neurotensin receptor 1; neurotensin receptor 1 (high affinity); neurotensin receptor type 1; NT receptor-1; NT1 receptor; NT-1r; NTR; NTR1; NT-R-1; NTR-1; NTRH; NTRR; NTS1; NTS-1; Ntsr; Ntsr1; RNTR1; Spp382; TIP39
Gene	NTSR1
Product Type	Antibody
Gene ID (Entrez)	4923
Formulation	Whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to the C-terminal amino acids K(398)ADSVSSNHTLSSNATRETLY(418) of NTSR1.
Classification	Polyclonal
Primary or Secondary	Primary

868

Invitrogen™ CD20 Recombinant Mouse Monoclonal Antibody (18B12)

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Functional Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P19437
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD20
Gene Symbols	Ms4a1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7
Gene	Ms4a1
Product Type	Antibody
Gene ID (Entrez)	12482
Formulation	PBS with 0.02% ProClin 300
Immunogen	This antibody was generated by immunizing CD20-/- mice with CD20-transfected cell lines (300.18 and 70Z3) and CD20-peptide-keyhole limpet hemocyanin conjugate.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	18B12

869

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P37173
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	TGFBR2
Gene Symbols	TGFBR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene	TGFBR2
Product Type	Antibody
Gene ID (Entrez)	7048
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11

870

Invitrogen™ Ovalbumin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Chicken
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P01012
Isotype	IgG
Concentration	1 mg/mL
Antigen	Ovalbumin
Gene Symbols	OVAL
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Allergen Gal d II; clade (ovalbumin); egg albumin; Gal d 2; member 14; OVA; OVAL; Ovalbumin; ovalbumin (SERPINB14); plakalbumin; serpin peptidase inhibitor; SERPINB14; unnamed protein product
Gene	OVAL
Product Type	Antibody
Gene ID (Entrez)	396058
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Ovalbumin.
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ PAX4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PPAR gamma-2 Polyclonal Antibody, Alexa Fluor™ 647 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Endothelin 2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HSF1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Endothelin A Receptor Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Endothelin 1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GPR20 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CXCR7 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PTH1R Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SSTR5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NPS Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NTSR1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD20 Recombinant Mouse Monoclonal Antibody (18B12) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PAX4 Polyclonal Antibody

Invitrogen™ PPAR gamma-2 Polyclonal Antibody, Alexa Fluor™ 647

Invitrogen™ Endothelin 2 Polyclonal Antibody

Invitrogen™ HSF1 Polyclonal Antibody

Invitrogen™ Endothelin A Receptor Polyclonal Antibody

Invitrogen™ Endothelin 1 Polyclonal Antibody

Invitrogen™ GPR20 Polyclonal Antibody

Invitrogen™ CXCR7 Polyclonal Antibody

Invitrogen™ PTH1R Polyclonal Antibody

Invitrogen™ SSTR5 Polyclonal Antibody

Invitrogen™ NPS Polyclonal Antibody

Invitrogen™ NTSR1 Polyclonal Antibody

Invitrogen™ CD20 Recombinant Mouse Monoclonal Antibody (18B12)

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)